PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna28293.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 260aa    MW: 29916.4 Da    PI: 9.1753
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna28293.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.53.5e-191764148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WT eEd ll+++v+++G g+W+++ar  g++R +k+c++rw +yl
  mrna28293.1-v1.0-hybrid 17 KGPWTSEEDRLLIEYVRLHGEGRWNSVARLAGLKRNGKSCRLRWVNYL 64
                             79********************************************97 PP

2Myb_DNA-binding51.71.9e-1670114147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              rg  T+ E+ +++++++++G++ W+tIar ++ gRt++++k++w+++
  mrna28293.1-v1.0-hybrid  70 RGQITPHEESIILQLHARWGNR-WSTIARSLP-GRTDNEIKNYWRTH 114
                              7888******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.7561268IPR017930Myb domain
SuperFamilySSF466892.93E-3014111IPR009057Homeodomain-like
SMARTSM007171.4E-161666IPR001005SANT/Myb domain
PfamPF002491.3E-171764IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.9E-241871IPR009057Homeodomain-like
CDDcd001673.84E-121964No hitNo description
PROSITE profilePS5129419.32469119IPR017930Myb domain
SMARTSM007171.3E-1469117IPR001005SANT/Myb domain
PfamPF002491.1E-1370114IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.7E-2472118IPR009057Homeodomain-like
CDDcd001672.85E-1074115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 260 aa     Download sequence    Send to blast
MAAHMGWGII EEEGWRKGPW TSEEDRLLIE YVRLHGEGRW NSVARLAGLK RNGKSCRLRW  60
VNYLRPDLKR GQITPHEESI ILQLHARWGN RWSTIARSLP GRTDNEIKNY WRTHFKKKAK  120
VPSDASEKAK SRLLRRQQFH QQQQQQQQQH QADMKRIMAL LDENDTKISS WPPQAAQGNQ  180
DMDTTSTTAF HNHTCTEEQG FFYSMLNGNV PHVVEASSSE DSFLWDGLWN LDDVHGNFTT  240
SACATGKAST FHNFVVPFS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C7e-281711927128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004296547.10.0PREDICTED: myb-related protein 305 isoform X1
SwissprotP813911e-55MYB05_ANTMA; Myb-related protein 305
TrEMBLM5XSD51e-136M5XSD5_PRUPE; Uncharacterized protein
STRINGGLYMA10G26681.11e-111(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF118234108
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24310.12e-92myb domain protein 305